tech@sbsbio.com
from China, for the World
for
S
uperior
B
iology
S
ervices since
2000
Home
Product
All Products
Custom Services
Catalog Products
Innovative Systems
Nucleic Acid Related
Natural Compounds
Synthetic Biology
Enzymes
POCT Solution
LAMP
RPA
CRISPR
DNA-Free Enzymes
Freeze-Drying System
Lateral Flow System
About
About SBS
Achievements
Ecosystem
Legal Statement
Contact
…
Home
Product
All Products
Custom Services
Catalog Products
Innovative Systems
Nucleic Acid Related
Natural Compounds
Synthetic Biology
Enzymes
POCT Solution
LAMP
RPA
CRISPR
DNA-Free Enzymes
Freeze-Drying System
Lateral Flow System
About
About SBS
Achievements
Ecosystem
Legal Statement
Contact
Login
tech@sbsbio.com
from China, for the World
for
S
uperior
B
iology
S
ervices since
2000
Home
Product
All Products
Custom Services
Catalog Products
Innovative Systems
Nucleic Acid Related
Natural Compounds
Synthetic Biology
Enzymes
POCT Solution
LAMP
RPA
CRISPR
DNA-Free Enzymes
Freeze-Drying System
Lateral Flow System
About
About SBS
Achievements
Ecosystem
Legal Statement
Contact
…
Home
Product
All Products
Custom Services
Catalog Products
Innovative Systems
Nucleic Acid Related
Natural Compounds
Synthetic Biology
Enzymes
POCT Solution
LAMP
RPA
CRISPR
DNA-Free Enzymes
Freeze-Drying System
Lateral Flow System
About
About SBS
Achievements
Ecosystem
Legal Statement
Contact
Login
All Categories - SBS Genetech - for Superior Biology Services since 2000
All
Synthetic Biology
DNA-Free Enzymes
RUO Kits
Magnetic Beads
Reference Standard
Next Generation Sequencing
Microspheres
Natural Compounds
Exosome
Quick-Dissolve Pellets
Sequencing
Glycobiology
Signal Transduction
IVD Bulk Reagents
Peptide-Related
Protein-Related
PCR-Related
RNA-Related
Enzyme
Isothermal Amplification
RNA Silencing
Nucleic Acid Purification
Antibody
DNA Stain
Nuclease
Biochemicals
Extracts
DNA Markers
CRISPR Gene Editing
Genetic Manipulation
Lab Supplies
Nucleic Acid Test
Freeze-Drying System
Lateral Flow System
Cell-Related
Buy now
Recombinant Human ME2, His-tag
NAD-dependent malic enzyme (ME2), mitochondrial is a protein that in humans is encoded by the ME2 gene. This gene encodes a mitochondrial NAD-dependent malic enzyme, a homotetrameric protein, which catalyzes the oxidative decarboxylation of malate to pyruvate. Three different isoforms of ME are known to be in mammalian tissues: a strictly cytosolic NADP+-dependent enzyme, an NADP+-dependent mitochondriail isoform, and a mitochondrial isoenzyme that is able to use both NAD+ and NADP+ but is more effective with NAD+. The mammalian isoforms size is about 62-64kDa. A native size of 240,000 Da proposes a tetrameric structure for the active enzyme.
$223.00 - $4,330.00
Buy now
Recombinant Human PDI
Protein disulfide isomerases (PDIs) constitute a family of structurally related enzymes which catalyze disulfide bonds formation, reduction, or isomerization of newly synthesized proteins in the lumen of the endoplasmic reticulum (ER). They act also as chaperones, and are, therefore, part of a quality-control system for the correct folding of the proteins in the same subcellular compartment. PDI has been found to have moderate effects (25-fold) on the rate of oxidative folding of proteins in vitro. Recombinant Human Protein Disulfide Isomerase is involved in disulphide-bond formation and isomerization, as well as the reduction of disulphide bonds in proteins. Recombinant PDI has been found to have moderate effects (25-fold) on the rate of oxidative folding of proteins in vitro.
$906.00 - $1,597.00
Buy now
Recombinant Human PTHrP, 15N
PTHrP, also named parathyroid hormone-related protein, is belonging to the parathyroid hormone family. PTHrP is expressed in cancer cells (breast cancer, certain types of lung cancer including squamous cell lung carcinoma). The receptor for PTHrP is PTHR1. PTHrP plays a central role in regulating the hypercalcemia. Recombinant human PTHrP (15N Stable Isotope Labeled) is a 10.0kDa linear polypeptide of 86 amino acid residues and it shares 86%a.a. identity with murine PTHLH.
$223.00 - $2,166.00
Buy now
Recombinant Human PTHrP
PTHrP, also named parathyroid hormone-related protein, is belonging to the parathyroid hormone family. PTHrP is expressed in cancer cells (breast cancer, certain types of lung cancer including squamous cell lung carcinoma). The receptor for PTHrP is PTHR1. PTHrP plays a central role in regulating the hypercalcemia. Recombinant human PTHrP is a 9.9kDa linear polypeptide of 86 amino acid residues and it shares 86%a.a. identity with murine PTHLH.
$223.00 - $1,806.00
Buy now
Recombinant mEGFP-PA-tag
Beyotime's Recombinant mEGFP-PA-tag was expressed in E. coli and purified, which contains the full length of mEGFP with PA-tag at the C-terminus. mEGFP is one of the most widely used engineered variants of the original wild-type Green Fluorescent Protein (GFP). mEGFP exhibits greater fluorescence stability and brighter than the wild-type GFP.<br>PA-tag is a synthetic peptide consisting of 12 amino acids (GVAMPGAEDDVV). PA-tagged proteins in a dilute sample can be captured by immobilized NZ-1 antibody resin in a near complete fashion and eluted by a solution of free PA14 peptide or 10mM MES pH6.0, 3M MgCl2. The PA tag system proves to outperform many existing affinity tag systems owing to its high affinity, high selectivity, and extended reusability [1].
$120.00 - $733.00
Buy now
Recombinant mEGFP-Twin-Strep-tag
Beyotime's Recombinant mEGFP-Twin-Strep-tag was expressed in E.coli and purified, which contains the full length of mEGFP with Twin-Strep-tag at the C-terminus. mEGFP is one of the most widely used engineered variants of the original wild-type Green Fluorescent Protein (GFP). mEGFP exhibits greater fluorescence stability and brighter than the wild-type GFP.<br>Twin-Strep-tag uses the principle of avidity to link two Strep-tag II together by linker (Twin-Strep-tag and linker sequence: WSHPQFEKGGGSGGGSGGSAWSHPQFEK). This peptide sequence exhibits intrinsic affinity towards Strep-Tactin or Strep-Tactin XT, a specifically engineered streptavidin, and can be N- or C-terminally fused to recombinant proteins. Twin-strep-tag improves the link between the target protein and Strep-Tactin or Strep-Tactin XT, improves the purification of low-concentration samples, and can also be used to grasp protein complexes and detect interactions between proteins [1-2].
$120.00 - $733.00
Buy now
Recombinant mEGFP-Strep-tag II
Beyotime's Recombinant mEGFP-Strep-tag II was expressed in E.coli and purified, which contains the full length of mEGFP with Strep-tag II at the C-terminus. mEGFP is one of the most widely used engineered variants of the original wild-type Green Fluorescent Protein (GFP). mEGFP exhibits greater fluorescence stability and brighter than the wild-type GFP.<br>Strep-tag II is a synthetic peptide consisting of eight amino acids (WSHPQFEK). This peptide sequence exhibits intrinsic affinity towards Strep-Tactin, a specifically engineered streptavidin, and can be N- or C-terminally fused to recombinant proteins. By exploiting the highly specific interaction, Strep-tagged proteins can be isolated in one step from crude cell lysates. Because the Strep-tag elutes under gentle, physiological conditions, it is especially suited for the purification of functional proteins [1-2].
$120.00 - $733.00
Buy now
Recombinant Maltose Binding Protein (His-tag)
Beyotime's Recombinant Maltose Binding Protein (His-tag) was expressed in Escherichia coli (E. coli) and purified, which contains the mature form of maltose binding protein (27-392aa) with 6X His-tag (HHHHHH) at the C-terminus.<br>The maltose binding protein (MBP), also known as MalE, is a key component of the maltose/maltodextrin ATP-binding cassette (ABC) transporter system in E. coli. It resides in the periplasm and specifically binds maltose and maltodextrins such as maltotriose with high affinity. Upon substrate binding, MBP undergoes a conformational change and interacts with the maltose transporter complex (MalFGK₂), facilitating the ATP-dependent active transport of the ligand into the cytoplasm [1].
$132.00 - $1,100.00
Buy now
Recombinant Human TIM4 (His-Tag&Avi-Tag)
Beyotime's Recombinant Human TIM4 (His-Tag&Avi-Tag) was expressed in HEK293 and purified, which contain the extracellular domain (25-314aa) of human TIM4 with His-Tag and Avi-Tag fusion at the C-terminus.<br>TIMs are type I transmembrane proteins, with the N terminus containing the variable Ig-like (IgV) domain extending from the plasma membrane and the C-terminal tail largely mediating intracellular signaling oriented toward the cytosol. The Tim gene family consists of eight members (Tim-1-8) on mouse chromosome 11B1.1 and three members (Tim-1, Tim-3, and Tim-4) on human chromosome 5q33.2. TIM1, TIM2, and TIM3 were all found to be expressed by T cells and involved in the regulation of Th cells. TIM4 is different from other TIM molecules in that it is expressed exclusively on antigen-presenting cells (APCs), particularly on mature myeloid-derived DCs and macrophages but not by lymphocytes.<br>Mature human TIM4 consists of a 290aa extracellular domain (ECD), a 21aa transmembrane segment and a 43aa cytoplasmic tail. TIM4 is involved in immune regulation such as to initiate skewed Th2 polarization and to mediate phagocytosis of apoptotic cells. TIM4 also binds specifically to TIM1 which is
$166.00 - $7,666.00
Buy now
Recombinant Biotinylated Human TIM4 (Avi-Tag)
Beyotime's Recombinant Biotinylated Human TIM4 (Avi-Tag) was expressed in E.coli and purified, which contain the Ig-like V domain (25-126aa) of full length of TIM-4 with His-Tag and Avi-Tag fusion at the C-terminus. Biotin Labeling Kit for Avi-tag Protein with BirA (P0630) was used to achieve biotin labeling of Human TIM4.<br>TIMs are type I transmembrane proteins, with the N terminus containing the variable Ig-like (IgV) domain extending from the plasma membrane and the C-terminal tail largely mediating intracellular signaling oriented toward the cytosol. The Tim gene family consists of eight members (Tim-1-8) on mouse chromosome 11B1.1 and three members (Tim-1, Tim-3, and Tim-4) on human chromosome 5q33.2. TIM1, TIM2, and TIM3 were all found to be expressed by T cells and involved in the regulation of Th cells. TIM4 is different from other TIM molecules in that it is expressed exclusively on antigen-presenting cells (APCs), particularly on mature myeloid-derived DCs and macrophages but not by lymphocytes.<br>Mature human TIM4 consists of a 290aa extracellular domain (ECD), a 21aa transmembrane segment and a 43aa cytoplasmic tail. TIM4 is involved in immune regulation such as to initiat
$200.00 - $2,333.00
Buy now
Recombinant Human MBD2 (hFc-Tag, HEK293)
Beyotime's recombinant human MBD2 (hFc-Tag) contains the Methyl-CpG-binding domain (Ala143-Leu230) with Fc (Fragment crystallizable) region of human IgG1 fusion at the C-terminus. Fusion with the Fc domain can improve the solubility and stability of protein both in vivo and in vitro. This protein was expressed in HEK293 cells and purified. Due to N-glycosylation site and hinge region of hFc, it migrates as an approximately 40kDa/80kDa protein in SDS-PAGE gel under reduced/non-reduced conditions.<br>DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian transcriptional regulation. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, except for MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. The MBD2 protein encoded by the MBD2 gene may function as a mediator of the biological consequences of the methylation signal. It is also reported that this protein functions as a demethylase to activate transcription, as DNA meth
$76.00 - $2,733.00
Buy now
Recombinant Active Human COX1 (His & Twin-Strep-Tag)
Beyotime's recombinant human active form of human COX1 (rhCOX1) was expressed in HEK293 cells and purified, which contains the full length of COX1 (24-599aa) with a His tag (8X His) and a Twin-Strep tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) at the C-terminus.<br>Cyclooxygenase is a bifunctional enzyme that first catalyzes the addition of two moles of molecular oxygen to arachidonic acid to form the hydroperoxide PGG2, then reduces the hydroperoxide to the alcohol, PGH2, by a peroxidase activity. Cyclooxygenase is found in two forms: COX1, which is constitutively expressed in most cells, is responsible for the production of prostaglandins that maintain homeostasis; and COX2, which is upregulated in inflammatory cells in response to an inflammatory stimulus (cytokines, LPS, etc.), is responsible for the production of prostaglandins at the site of inflammation [1].
$533.00 - $6,333.00
Buy now
Recombinant Active Human COX1 (His & Twin-Strep-Tag)
Beyotime's recombinant human active form of human COX1 (rhCOX1) was expressed in HEK293 cells and purified, which contains the full length of COX1 (24-599aa) with a His tag (8X His) and a Twin-Strep tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) at the C-terminus.<br>Cyclooxygenase is a bifunctional enzyme that first catalyzes the addition of two moles of molecular oxygen to arachidonic acid to form the hydroperoxide PGG2, then reduces the hydroperoxide to the alcohol, PGH2, by a peroxidase activity. Cyclooxygenase is found in two forms: COX1, which is constitutively expressed in most cells, is responsible for the production of prostaglandins that maintain homeostasis; and COX2, which is upregulated in inflammatory cells in response to an inflammatory stimulus (cytokines, LPS, etc.), is responsible for the production of prostaglandins at the site of inflammation [1].
$533.00 - $6,333.00
Buy now
Recombinant Human Rac2 (Flag-Tag)
Beyotime's recombinant human Rac2 (rhRac2) was expressed in E.coli and purified, which contains the mature form Rac2 (2-189aa) with Flag tag (DYKDDDDK) at C-terminus. Rac2 involves in the regulation of cell growth, cytoskeletal reorganization, and the activation of protein kinases by regulating the expression of effector proteins. Rac2 has also been shown to interact with ARHGDIA and Nitric oxide synthase 2A [1].
$160.00 - $4,666.00
Buy now
Recombinant Human Rac1 (T17N, Flag-Tag)
Beyotime's recombinant human Rac1 T17N (rhRac1 T17N) was expressed in E.coli and purified, which contains the mature form Rac1 (2-189aa) with Flag tag (DYKDDDDK) at the C-terminus. Rac1 is involved in the regulation a diverse array of cellular events, including the control of GLUT4 translocation to glucose uptake, cell growth, cytoskeletal reorganization, antimicrobial cytotoxicity, and the activation of protein kinases [1]. T17N is a dominant negative mutation on the p-loop that prevents GTP binding and reduces GDP binding [2-3].
$160.00 - $3,767.00
Buy now
Recombinant Human Rac1 (Q61L, Flag-Tag)
Beyotime's recombinant human Rac1 Q61L (rhRac1 Q61L) was expressed in E.coli and purified, which contains the mature form Rac1 (2-189aa) with Flag tag (DYKDDDDK) at the C-terminus. Rac1 is involved in the regulation a diverse array of cellular events, including the control of GLUT4 translocation to glucose uptake, cell growth, cytoskeletal reorganization, antimicrobial cytotoxicity, and the activation of protein kinases [1].<br>Rac1 Q61L is a constitutively active Rac1 mutant that locks Rac1 at the GTP-bound state by disrupting its GTPase activity [2-3].
$160.00 - $3,767.00
Buy now
Recombinant Human Rac1 (Flag-Tag)
Beyotime's recombinant human Rac1 (rhRac1) was expressed in E.coli and purified, which contains the mature form Rac1 (2-189aa) with Flag tag (DYKDDDDK) at the C-terminus.<br>Rac1 is involved in the regulation a diverse array of cellular events, including the control of GLUT4 translocation to glucose uptake, cell growth, cytoskeletal reorganization, antimicrobial cytotoxicity and the activation of protein kinases [1].
$160.00 - $2,900.00
Buy now
Recombinant Human Cdc42 (G12V, Flag-Tag)
Beyotime's recombinant human Cdc42 (rhCdc42 G12V) was expressed in E.coli and purified, which contains the mature form Cdc42 (2-188aa) with Flag tag (DYKDDDDK) at the C-terminus.<br>Cdc42 is involved in the regulation of a variety of tumor and non-tumor diseases through a cascade of multiple signaling pathways. Active Cdc42 can regulate intercellular adhesion, cytoskeleton formation, and cell cycle, thus affecting cell proliferation, transformation, and dynamic balance as well as migration and invasion of tumor cells by regulating the expression of effector proteins [1].<br>G12V and Q61L mutations of CDC42 cause GAP insensitivity leading to sustained hyperactivation of CDC42 [2-3].
$160.00 - $3,766.00
Buy now
Recombinant Human Cdc42 (Q61L, Flag-Tag)
Beyotime's recombinant human Cdc42 (rhCdc42 Q61L) was expressed in E.coli and purified, which contains the mature form Cdc42 (2-188aa) with Flag tag (DYKDDDDK) at the C-terminus.<br>Cdc42 is involved in the regulation of a variety of tumor and non-tumor diseases through a cascade of multiple signaling pathways. Active Cdc42 can regulate intercellular adhesion, cytoskeleton formation, and cell cycle, thus affecting cell proliferation, transformation, and dynamic balance as well as migration and invasion of tumor cells by regulating the expression of effector proteins [1].<br>G12V and Q61L mutations of CDC42 cause GAP insensitivity leading to sustained hyperactivation of CDC42 [2-3].
$160.00 - $3,766.00
Buy now
Recombinant Human Cdc42 (Flag-Tag)
Beyotime's recombinant human Cdc42 (rhCdc42) was expressed in E.coli and purified, which contains the mature form Cdc42 (2-188aa) with Flag tag (DYKDDDDK) at the C-terminus. Cdc42 is involved in the regulation of a variety of tumor and non-tumor diseases through a cascade of multiple signaling pathways. Active Cdc42 can regulate intercellular adhesion, cytoskeleton formation, and cell cycle, thus affecting cell proliferation, transformation, and dynamic balance as well as migration and invasion of tumor cells by regulating the expression of effector proteins [1].
$133.00 - $2,900.00
Show more
Home
Journals
Contact
Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Accept
Learn More
